(data stored in ACNUC7421 zone)

EMBL: AP009493.PE161

AP009493.PE161       Location/Qualifiers
FT   CDS             168477..169292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_161"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_161"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16990"
FT                   /db_xref="GOA:B1VNG7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG7"
FT                   /protein_id="BAG16990.1"
FT                   /translation="MSTVTTADTAGPPAAPKSWAALGPLTARSLKSCLRTPSLLLSPLL
FT                   TSAFFMIIYEGQLSSVTAAATPGGRYIDVVLPLCLLTTAFTGGATAGQLFVNDIGSGYH
FT                   ARLWLTPVGRWALLAAPVMAGVVVLAAQAAALTGLGLLLGLDPVTGAPAILAIISATVL
FT                   LGTGFLLLAGAVGLHTGNSSAVGSVTLVFFPLSFFTATFVPRDQLGGWMAHAADVNPLT
FT                   PPLEAMRGLLTAPWNEQNLLPGALVALAILVTGAAAAHLALTRRTRTGV"
     MSTVTTADTA GPPAAPKSWA ALGPLTARSL KSCLRTPSLL LSPLLTSAFF MIIYEGQLSS        60
     VTAAATPGGR YIDVVLPLCL LTTAFTGGAT AGQLFVNDIG SGYHARLWLT PVGRWALLAA       120
     PVMAGVVVLA AQAAALTGLG LLLGLDPVTG APAILAIISA TVLLGTGFLL LAGAVGLHTG       180
     NSSAVGSVTL VFFPLSFFTA TFVPRDQLGG WMAHAADVNP LTPPLEAMRG LLTAPWNEQN       240
     LLPGALVALA ILVTGAAAAH LALTRRTRTG V                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page