(data stored in ACNUC7421 zone)

EMBL: AP009493.PE163

AP009493.PE163       Location/Qualifiers
FT   CDS             170129..170332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_163"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16992"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG9"
FT                   /protein_id="BAG16992.1"
FT                   /translation="MGNPNPIQRRGVRPPTTNLNHAPAGPRGKEHEQASPADPGRPRTP
FT                   VFCSPSSGTSLNTTIRHAGGTP"
     MGNPNPIQRR GVRPPTTNLN HAPAGPRGKE HEQASPADPG RPRTPVFCSP SSGTSLNTTI        60
     RHAGGTP                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page