(data stored in ACNUC7421 zone)

EMBL: AP009493.PE164

AP009493.PE164       Location/Qualifiers
FT   CDS             170329..170535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_164"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16993"
FT                   /db_xref="GOA:B1VNH0"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNH0"
FT                   /protein_id="BAG16993.1"
FT                   /translation="MSDRTRMLLIAAALLAAAGIIAWLTWGTLWLLASMALTFSAVPLL
FT                   VGAFFDGDGNDPGSSNGGVGLGL"
     MSDRTRMLLI AAALLAAAGI IAWLTWGTLW LLASMALTFS AVPLLVGAFF DGDGNDPGSS        60
     NGGVGLGL                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page