(data stored in ACNUC7421 zone)

EMBL: AP009493.PE165

AP009493.PE165       Location/Qualifiers
FT   CDS             complement(170945..172690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_165"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16994"
FT                   /db_xref="InterPro:IPR025295"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNH1"
FT                   /protein_id="BAG16994.1"
FT                   /translation="MRAQGNAGRPESERTDRTPGRTPATVPAGADGAQPAGLQPLQGSV
FT                   GNAAVVQMLRRAGHTGVQTAEQERHQHGPDCDHQQAETPAVQRAAAPQVQRRSAVHDVL
FT                   RTGGRPLDDSTRTDMESRLGADFSDVRIHNDRAAKASAAEVGARAYTSGSHIVIGDGGA
FT                   DKHTLAHELTHVIQQRQGPVAGTDNGSGLKVSDPSDRFEREAEANASRVMSSAAPVLQR
FT                   RPADAPGRAAAAPVVQRMPKAKKASPEARANKEFARAVKSQFEAKGWIADGSPEVWARM
FT                   TLHKIGGMDAQQAAAFKSSNAAYKASPDNTMGPRSYAGEPDKQAMRWVSTVVKNYLTEK
FT                   GENPIEIQAAIHGEKLYIAGNTTAANSLLASELGGLSGSAFLKKVLKEYPADSDDLLRG
FT                   DAEGRLARHSDKTDKRIANDSADEAVTEKYANVITALAEPVTVASGGDEGYHAERRIVD
FT                   HLTGDEPEKVIPDSLAGTKRPCVSCYANLFIGTEARPGPLWISGAANIGMAGYSAKNAT
FT                   RFVSRVDDAIGNTYATLQWECDADHEITIATTGGSPKTTIDYGTDSDSDTDGNRRRLTE
FT                   AMETE"
     MRAQGNAGRP ESERTDRTPG RTPATVPAGA DGAQPAGLQP LQGSVGNAAV VQMLRRAGHT        60
     GVQTAEQERH QHGPDCDHQQ AETPAVQRAA APQVQRRSAV HDVLRTGGRP LDDSTRTDME       120
     SRLGADFSDV RIHNDRAAKA SAAEVGARAY TSGSHIVIGD GGADKHTLAH ELTHVIQQRQ       180
     GPVAGTDNGS GLKVSDPSDR FEREAEANAS RVMSSAAPVL QRRPADAPGR AAAAPVVQRM       240
     PKAKKASPEA RANKEFARAV KSQFEAKGWI ADGSPEVWAR MTLHKIGGMD AQQAAAFKSS       300
     NAAYKASPDN TMGPRSYAGE PDKQAMRWVS TVVKNYLTEK GENPIEIQAA IHGEKLYIAG       360
     NTTAANSLLA SELGGLSGSA FLKKVLKEYP ADSDDLLRGD AEGRLARHSD KTDKRIANDS       420
     ADEAVTEKYA NVITALAEPV TVASGGDEGY HAERRIVDHL TGDEPEKVIP DSLAGTKRPC       480
     VSCYANLFIG TEARPGPLWI SGAANIGMAG YSAKNATRFV SRVDDAIGNT YATLQWECDA       540
     DHEITIATTG GSPKTTIDYG TDSDSDTDGN RRRLTEAMET E                           581
//

If you have problems or comments...

PBIL Back to PBIL home page