(data stored in ACNUC7421 zone)

EMBL: AP009493.PE166

AP009493.PE166       Location/Qualifiers
FT   CDS             173275..173697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_166"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16995"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNH2"
FT                   /protein_id="BAG16995.1"
FT                   /translation="MLQSSLPRMPESCLRSAGLRAWKVPSRNSGTASSAWARSCRPGSV
FT                   MVTAYARRSAASRSRRTWPACSRLSQMPTITLRSMRSSSLRTRCELGPTSASIFSTRCW
FT                   PTPSPSAPALASAARATAAEARHRAMSKRSAASRGK"
     MLQSSLPRMP ESCLRSAGLR AWKVPSRNSG TASSAWARSC RPGSVMVTAY ARRSAASRSR        60
     RTWPACSRLS QMPTITLRSM RSSSLRTRCE LGPTSASIFS TRCWPTPSPS APALASAARA       120
     TAAEARHRAM SKRSAASRGK                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page