(data stored in ACNUC7421 zone)

EMBL: AP009493.PE169

AP009493.PE169       Location/Qualifiers
FT   CDS             complement(175312..175578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_169"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16998"
FT                   /db_xref="GOA:B1VNH5"
FT                   /db_xref="InterPro:IPR025329"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNH5"
FT                   /protein_id="BAG16998.1"
FT                   /translation="MKASKVAYKPMGFVLGALSGMIASAVFKQTWKVVEGEGDAPDALD
FT                   EDRPWRQILLAAAIQGAIFAVVKATVERSGAQATRRVTGTWPA"
     MKASKVAYKP MGFVLGALSG MIASAVFKQT WKVVEGEGDA PDALDEDRPW RQILLAAAIQ        60
     GAIFAVVKAT VERSGAQATR RVTGTWPA                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page