(data stored in ACNUC7421 zone)

EMBL: AP009493.PE170

AP009493.PE170       Location/Qualifiers
FT   CDS             complement(175575..176030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_170"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16999"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNH6"
FT                   /protein_id="BAG16999.1"
FT                   /translation="MNDESRNKMGTPTPEEVREQVERTRDELGQTVEALAGKADVKAQA
FT                   AEKTAAVKEQAAAATAQIREKTMHAAETVKNRTPDVVQEKTAQAATQVRESAAQAGQFV
FT                   MDRTPEPLLEKADRAGRAARANRTPLLAGGALLIAFLLIRRGRGRNK"
     MNDESRNKMG TPTPEEVREQ VERTRDELGQ TVEALAGKAD VKAQAAEKTA AVKEQAAAAT        60
     AQIREKTMHA AETVKNRTPD VVQEKTAQAA TQVRESAAQA GQFVMDRTPE PLLEKADRAG       120
     RAARANRTPL LAGGALLIAF LLIRRGRGRN K                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page