(data stored in ACNUC7421 zone)

EMBL: AP009493.PE171

AP009493.PE171       Location/Qualifiers
FT   CDS             complement(176027..176443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_171"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_171"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17000"
FT                   /db_xref="GOA:B1VNH7"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNH7"
FT                   /protein_id="BAG17000.1"
FT                   /translation="MSTAGRQTPSTSEEPVGVLVSRASQQISELVREEMLLARSEMTEK
FT                   GKRFGKGGGLFGAAGIVGILAAQALVATCIAALALALPLWAAALIVTVVLAAVAGMAAL
FT                   AGKKQVARAGTPAPEQTINSVKADVAEVKERVHR"
     MSTAGRQTPS TSEEPVGVLV SRASQQISEL VREEMLLARS EMTEKGKRFG KGGGLFGAAG        60
     IVGILAAQAL VATCIAALAL ALPLWAAALI VTVVLAAVAG MAALAGKKQV ARAGTPAPEQ       120
     TINSVKADVA EVKERVHR                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page