(data stored in ACNUC7421 zone)

EMBL: AP009493.PE173

AP009493.PE173       Location/Qualifiers
FT   CDS             complement(177562..177831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_173"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17002"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNH9"
FT                   /protein_id="BAG17002.1"
FT                   /translation="MDRKITGHSVLGASQRCYGMHGHFGAYRWDISTQAVVATKFRAMP
FT                   VGMMRKSACLVTTRAAVHGRTPTQRRTPFDDVSPDRSPLLNIFL"
     MDRKITGHSV LGASQRCYGM HGHFGAYRWD ISTQAVVATK FRAMPVGMMR KSACLVTTRA        60
     AVHGRTPTQR RTPFDDVSPD RSPLLNIFL                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page