(data stored in ACNUC7421 zone)

EMBL: AP009493.PE176

AP009493.PE176       Location/Qualifiers
FT   CDS             complement(179227..179610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_176"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17005"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNI2"
FT                   /protein_id="BAG17005.1"
FT                   /translation="MAERARAELADAVQACRVCRAQAVRYRTLIDRARFWAFATLVAGP
FT                   VGRWFTEPRGTASASGRSLLAAGQGAASAQFGGRAVAHDSAPWYRWRPLPPAPGPGVAS
FT                   TQPIRCVTAPVRNPGCVTDSAEW"
     MAERARAELA DAVQACRVCR AQAVRYRTLI DRARFWAFAT LVAGPVGRWF TEPRGTASAS        60
     GRSLLAAGQG AASAQFGGRA VAHDSAPWYR WRPLPPAPGP GVASTQPIRC VTAPVRNPGC       120
     VTDSAEW                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page