(data stored in ACNUC7421 zone)

EMBL: AP009493.PE179

AP009493.PE179       Location/Qualifiers
FT   CDS             complement(181916..182449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_179"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17008"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNI5"
FT                   /protein_id="BAG17008.1"
FT                   /translation="MKILEAVSYDVLMSRFTREHPYDPCDEANSNDEAAAHIRDAHRVL
FT                   CGRWHRVLLEGPEVLDVVLPWHLGEGGDVELIPPTGLTVAAAAIRLTALDATYTRTNPL
FT                   CALKLTRQTHAPARPLYLSTRAMPTRDYAALTVREGLVHLDGLHRMLAWHRSGMLAPGR
FT                   WVEAYLAGLPDAPG"
     MKILEAVSYD VLMSRFTREH PYDPCDEANS NDEAAAHIRD AHRVLCGRWH RVLLEGPEVL        60
     DVVLPWHLGE GGDVELIPPT GLTVAAAAIR LTALDATYTR TNPLCALKLT RQTHAPARPL       120
     YLSTRAMPTR DYAALTVREG LVHLDGLHRM LAWHRSGMLA PGRWVEAYLA GLPDAPG          177
//

If you have problems or comments...

PBIL Back to PBIL home page