(data stored in ACNUC7421 zone)

EMBL: AP009493.PE18

AP009493.PE18        Location/Qualifiers
FT   CDS             25180..26358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_18t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_18t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16847"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKL6"
FT                   /protein_id="BAG16847.1"
FT                   /translation="MLPPTPPPHSTGRSISPRTRRKTNQMRLCTTPLVRRIWTVELRPD
FT                   HGGSMLHCLQCSPSAPSVRTAPSQALTHLAGHARHDFLPRHLRTCQCHSHGCRWHPRHR
FT                   GCSGPVLLVLTRERGGRLWRLADTCAACAAATAHAAVVPDTVLATASPAESVKRIRQRR
FT                   RGRTPHGPSEQVRVREMLSYLAAALPARTSATARLLALQCALRSTVAGDVTIPAGLIRG
FT                   MRLPSEPSAFTELEAAGWLRSPTRPTQRAGFSVELLDTAVRMQAPTRADRARAANWILR
FT                   TCQMSEIRQLGTSPRLLALALAAHLPDEPGAPASAEQEVLARMCGLPPQELIPLLDTLA
FT                   ATHFLRSWAHGAVPEDLHWELDRHNHLTGNRSSLESDRVTSHTGQAEDPGAE"
     MLPPTPPPHS TGRSISPRTR RKTNQMRLCT TPLVRRIWTV ELRPDHGGSM LHCLQCSPSA        60
     PSVRTAPSQA LTHLAGHARH DFLPRHLRTC QCHSHGCRWH PRHRGCSGPV LLVLTRERGG       120
     RLWRLADTCA ACAAATAHAA VVPDTVLATA SPAESVKRIR QRRRGRTPHG PSEQVRVREM       180
     LSYLAAALPA RTSATARLLA LQCALRSTVA GDVTIPAGLI RGMRLPSEPS AFTELEAAGW       240
     LRSPTRPTQR AGFSVELLDT AVRMQAPTRA DRARAANWIL RTCQMSEIRQ LGTSPRLLAL       300
     ALAAHLPDEP GAPASAEQEV LARMCGLPPQ ELIPLLDTLA ATHFLRSWAH GAVPEDLHWE       360
     LDRHNHLTGN RSSLESDRVT SHTGQAEDPG AE                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page