(data stored in ACNUC7421 zone)

EMBL: AP009493.PE180

AP009493.PE180       Location/Qualifiers
FT   CDS             complement(182446..183249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_180"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17009"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNI6"
FT                   /protein_id="BAG17009.1"
FT                   /translation="MSGCTDFDTRVKDFPELGFLVLPGFLPASLVDRLVPEVDRWVDTG
FT                   LRQLSIDACSLAEDAAPPKFELQMAAHGDLAVYAPLLELLRDENLLGPSFVFHHLHSDR
FT                   RPPGGAGKSWHHDYEQHPQQDRALPMIHALHYLGGLRPGMGSLAVLPGSHHQIAEKDER
FT                   SALGTDWQPGEETIDDLPRGSTVLLHSAIFHTRRAARGPVEAAPRYMVDASYCTTGAPW
FT                   PPVKPYWRSVLAVGRTLEPARAQWPELFAERHFSPYVPRTQRPSA"
     MSGCTDFDTR VKDFPELGFL VLPGFLPASL VDRLVPEVDR WVDTGLRQLS IDACSLAEDA        60
     APPKFELQMA AHGDLAVYAP LLELLRDENL LGPSFVFHHL HSDRRPPGGA GKSWHHDYEQ       120
     HPQQDRALPM IHALHYLGGL RPGMGSLAVL PGSHHQIAEK DERSALGTDW QPGEETIDDL       180
     PRGSTVLLHS AIFHTRRAAR GPVEAAPRYM VDASYCTTGA PWPPVKPYWR SVLAVGRTLE       240
     PARAQWPELF AERHFSPYVP RTQRPSA                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page