(data stored in ACNUC7421 zone)

EMBL: AP009493.PE181

AP009493.PE181       Location/Qualifiers
FT   CDS             complement(183606..184649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_181"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17010"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNI7"
FT                   /protein_id="BAG17010.1"
FT                   /translation="MRRRTANDAEQRWGQEVAVDPVEEFAAWLRHLHREAKKPSYTEIV
FT                   RRIRMTDPTASVVVSTISETLNGKRLPRWTTVEPIARVLGGPTAAEECLRRWKQADAAR
FT                   TPTATQSDTAPIPDSIAPGLETEGAAAGSVASHSSFAPGRSGEAADPDQGAREGEAPVH
FT                   APRGRQSPVRMVSAASALAVAVAAWAAVTVIDDRNQAPAGGPTAVTPTALDPRPTGGTS
FT                   GAVADAPEAAAQPQFKPGTYETELTVNEGSWASPDGNIRIRVPGASTSDGPTIFVTTPS
FT                   VSCPQTTVAIGDALIVPEVSGSSWTRITTVKVWAEDTPNGEAFDMYVQLQVDQGTGRAP
FT                   QGQGCAS"
     MRRRTANDAE QRWGQEVAVD PVEEFAAWLR HLHREAKKPS YTEIVRRIRM TDPTASVVVS        60
     TISETLNGKR LPRWTTVEPI ARVLGGPTAA EECLRRWKQA DAARTPTATQ SDTAPIPDSI       120
     APGLETEGAA AGSVASHSSF APGRSGEAAD PDQGAREGEA PVHAPRGRQS PVRMVSAASA       180
     LAVAVAAWAA VTVIDDRNQA PAGGPTAVTP TALDPRPTGG TSGAVADAPE AAAQPQFKPG       240
     TYETELTVNE GSWASPDGNI RIRVPGASTS DGPTIFVTTP SVSCPQTTVA IGDALIVPEV       300
     SGSSWTRITT VKVWAEDTPN GEAFDMYVQL QVDQGTGRAP QGQGCAS                     347
//

If you have problems or comments...

PBIL Back to PBIL home page