(data stored in ACNUC7421 zone)

EMBL: AP009493.PE183

AP009493.PE183       Location/Qualifiers
FT   CDS             complement(184897..185169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_183"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17012"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNI9"
FT                   /protein_id="BAG17012.1"
FT                   /translation="MQSAPGLLPRRQFPGCDWSGRRGRVLGKADLDDALPGELPAGRGG
FT                   VLEPRYSPRMVSPFPAQWTAHRSSESLSLCVPLRQSRVVTSPWGR"
     MQSAPGLLPR RQFPGCDWSG RRGRVLGKAD LDDALPGELP AGRGGVLEPR YSPRMVSPFP        60
     AQWTAHRSSE SLSLCVPLRQ SRVVTSPWGR                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page