(data stored in ACNUC7421 zone)

EMBL: AP009493.PE185

AP009493.PE185       Location/Qualifiers
FT   CDS             185883..187124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_185"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17014"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNJ1"
FT                   /protein_id="BAG17014.1"
FT                   /translation="MMAAGTSTTGVRVGDRAVAEFLALGGQTLPLLRNWAGEEPGNGVA
FT                   RGLLTLATSERMDDRVLKQQLVTAHRDAQASGEREASLVYGVFLHTHRQYRLTADHLMA
FT                   HFERWPTDEVATLILDAFSAAGDSAYRVHGDALVEQQATLAGPDSWVWASCLAAVRAEQ
FT                   GRVREAHRLAEHALSRNPRSGVAVHALAHVEHELGTGPASTRMLDRWLAQDSQAVQLGH
FT                   LNWHAALQSIACGDFADARHRADTALRREDVGMRAATNWRLMLVGQEPARRSDLDHVRE
FT                   LLAAPGGMAEVFHTFNLALALAVEAATEDLETLAGRAAADPRPAYREVLAPVVGALAHI
FT                   TVGHPRAAAEGLAALGEKAEQIGGVRVEREIVQDTLARALIDAGDPARAAALLRHRTTT
FT                   RDHHTYENLLLAPR"
     MMAAGTSTTG VRVGDRAVAE FLALGGQTLP LLRNWAGEEP GNGVARGLLT LATSERMDDR        60
     VLKQQLVTAH RDAQASGERE ASLVYGVFLH THRQYRLTAD HLMAHFERWP TDEVATLILD       120
     AFSAAGDSAY RVHGDALVEQ QATLAGPDSW VWASCLAAVR AEQGRVREAH RLAEHALSRN       180
     PRSGVAVHAL AHVEHELGTG PASTRMLDRW LAQDSQAVQL GHLNWHAALQ SIACGDFADA       240
     RHRADTALRR EDVGMRAATN WRLMLVGQEP ARRSDLDHVR ELLAAPGGMA EVFHTFNLAL       300
     ALAVEAATED LETLAGRAAA DPRPAYREVL APVVGALAHI TVGHPRAAAE GLAALGEKAE       360
     QIGGVRVERE IVQDTLARAL IDAGDPARAA ALLRHRTTTR DHHTYENLLL APR              413
//

If you have problems or comments...

PBIL Back to PBIL home page