(data stored in ACNUC7421 zone)

EMBL: AP009493.PE187

AP009493.PE187       Location/Qualifiers
FT   CDS             complement(191655..192026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_187"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17016"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNJ3"
FT                   /protein_id="BAG17016.1"
FT                   /translation="MQERRLDDLLVRITEYTRPNACVLALLGSTGAWNTPALEHAFHAA
FT                   AATERPLVVDLTGLDFGDEVLLGILVQAHASLRGLVLVNPATGSFARRLHRTGVEELFN
FT                   TQSTLPLALAQLPSSPHPR"
     MQERRLDDLL VRITEYTRPN ACVLALLGST GAWNTPALEH AFHAAAATER PLVVDLTGLD        60
     FGDEVLLGIL VQAHASLRGL VLVNPATGSF ARRLHRTGVE ELFNTQSTLP LALAQLPSSP       120
     HPR                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page