(data stored in ACNUC7421 zone)

EMBL: AP009493.PE188

AP009493.PE188       Location/Qualifiers
FT   CDS             complement(192112..193500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_188"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17017"
FT                   /db_xref="GOA:B1VNJ4"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNJ4"
FT                   /protein_id="BAG17017.1"
FT                   /translation="MVGWLAGSCGEPRKEGGLLGGVEYPEGVRDDGLPAVLSDPARLAS
FT                   LEASGMVGSAPEQVFDDLTRLAVSVTGAAISAITFVGGARTYWKSVPHLPYGGSEQWQN
FT                   GVGESFCYFAVGANGPFIVEDAAKDPRTAGHQGIGPWGVGSWAGFPIVTTDGHAIGTMC
FT                   VIDANPRQWKPQELETLATLARAVSNEINLRISLSTAQSALATANAALSVSQDLARSLQ
FT                   ESLLPPVLRPVPGMDASARYLAATGDVEVVGDFYDLFNARGPWWTAVMGDVCGKGLEAA
FT                   KVTALARYTLRADAGDHLSPAEVLDRLNSAMRAQRAPRFLTAVQATFRTTPAGAAGRLC
FT                   LAGHPPALIRRADGRVQQTGLPGTLLGVMPTVSLSDVRFRLAPGDLLFLYTDGACEARP
FT                   DPSKPLPHRPIFDEEALAEALADTRGMDAADTNAHIAEVLAGHHGGWASDDTALLSLRV
FT                   PPRP"
     MVGWLAGSCG EPRKEGGLLG GVEYPEGVRD DGLPAVLSDP ARLASLEASG MVGSAPEQVF        60
     DDLTRLAVSV TGAAISAITF VGGARTYWKS VPHLPYGGSE QWQNGVGESF CYFAVGANGP       120
     FIVEDAAKDP RTAGHQGIGP WGVGSWAGFP IVTTDGHAIG TMCVIDANPR QWKPQELETL       180
     ATLARAVSNE INLRISLSTA QSALATANAA LSVSQDLARS LQESLLPPVL RPVPGMDASA       240
     RYLAATGDVE VVGDFYDLFN ARGPWWTAVM GDVCGKGLEA AKVTALARYT LRADAGDHLS       300
     PAEVLDRLNS AMRAQRAPRF LTAVQATFRT TPAGAAGRLC LAGHPPALIR RADGRVQQTG       360
     LPGTLLGVMP TVSLSDVRFR LAPGDLLFLY TDGACEARPD PSKPLPHRPI FDEEALAEAL       420
     ADTRGMDAAD TNAHIAEVLA GHHGGWASDD TALLSLRVPP RP                          462
//

If you have problems or comments...

PBIL Back to PBIL home page