(data stored in ACNUC7421 zone)

EMBL: AP009493.PE189

AP009493.PE189       Location/Qualifiers
FT   CDS             complement(194789..195655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_189"
FT                   /product="putative glutamate transporter glutamate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_189"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17018"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNJ5"
FT                   /protein_id="BAG17018.1"
FT                   /translation="MVALAGAALAGCSSEPSSLLAEGKIEIGSKGDQPGTSYSPHDGEF
FT                   NGFDITVAREVLDRVGVKVKSSDFEGVLSKNRARALHDGDVQLVAATYSITEQRMKPTS
FT                   EGGDGLDFVGPYASTRQGVLVRTEEAKRYKNHSDLNGRLICVWEGTTSAAELKKPAYSL
FT                   IRTVDMTDAQECVKALKEKRVDALSTDQLILYGFMKDDPSITVAHALTFGPFNDYGIAM
FT                   AKGHREDCKKLQQALMDYAQSNDWDRDFQINLPLVPKKDRDEARPTDDEIERSSCLDRP
FT                   SNAKVDG"
     MVALAGAALA GCSSEPSSLL AEGKIEIGSK GDQPGTSYSP HDGEFNGFDI TVAREVLDRV        60
     GVKVKSSDFE GVLSKNRARA LHDGDVQLVA ATYSITEQRM KPTSEGGDGL DFVGPYASTR       120
     QGVLVRTEEA KRYKNHSDLN GRLICVWEGT TSAAELKKPA YSLIRTVDMT DAQECVKALK       180
     EKRVDALSTD QLILYGFMKD DPSITVAHAL TFGPFNDYGI AMAKGHREDC KKLQQALMDY       240
     AQSNDWDRDF QINLPLVPKK DRDEARPTDD EIERSSCLDR PSNAKVDG                    288
//

If you have problems or comments...

PBIL Back to PBIL home page