(data stored in ACNUC7421 zone)

EMBL: AP009493.PE19

AP009493.PE19        Location/Qualifiers
FT   CDS             26497..26952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_19t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_19t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16848"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKM2"
FT                   /protein_id="BAG16848.1"
FT                   /translation="MQAIIDADGRLVIASARPVPGNEADAHTWRESDLPAIAAGTTVIA
FT                   DGAHLGTGLIVPHRRRARRPLLRGQEEDNAEHRCVRHPRRAHLRPHKELENPPRLPPER
FT                   RRPPPRRPSRRHTPQPRPWPHDPHDTRTRLHLPSTGHLQHALLIVSE"
     MQAIIDADGR LVIASARPVP GNEADAHTWR ESDLPAIAAG TTVIADGAHL GTGLIVPHRR        60
     RARRPLLRGQ EEDNAEHRCV RHPRRAHLRP HKELENPPRL PPERRRPPPR RPSRRHTPQP       120
     RPWPHDPHDT RTRLHLPSTG HLQHALLIVS E                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page