(data stored in ACNUC7421 zone)

EMBL: AP009493.PE191

AP009493.PE191       Location/Qualifiers
FT   CDS             complement(196543..197007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_191"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17020"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNJ7"
FT                   /protein_id="BAG17020.1"
FT                   /translation="MTGLPEISAELATYFSLTAEVLGAAMVASAAQRLTDGSIDAGQGY
FT                   FRRIFRRDSGEDTPIALPEGRSEQRADQLLGALSTEDRQRLAAALTAWLGEQRDRRPDE
FT                   ARLAELMAAAPTSHRTYHVTATGPNSAAIGSVGNGATFHFGGGSRHGDGA"
     MTGLPEISAE LATYFSLTAE VLGAAMVASA AQRLTDGSID AGQGYFRRIF RRDSGEDTPI        60
     ALPEGRSEQR ADQLLGALST EDRQRLAAAL TAWLGEQRDR RPDEARLAEL MAAAPTSHRT       120
     YHVTATGPNS AAIGSVGNGA TFHFGGGSRH GDGA                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page