(data stored in ACNUC7421 zone)

EMBL: AP009493.PE193

AP009493.PE193       Location/Qualifiers
FT   CDS             198260..198874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_193"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17022"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNJ9"
FT                   /protein_id="BAG17022.1"
FT                   /translation="MPSQSHSYADRGSPSCARPGGTVNRPLLFLDVDGPLNPYAAKPER
FT                   RPDGYTTLRVPRNDEHQDDRRLTSRRPLRVWLNPEHGRFLLQLGFELCWATTWMDDANR
FT                   WIAPVLGLPELPFVDFGDVLLRERPDGVHWKTGPLVDYAGGRPFAWVDDEQSELDQTFV
FT                   AAHHQGAGLLHHVNPRIGLRKNDFHLLADFARSLDTSRTTG"
     MPSQSHSYAD RGSPSCARPG GTVNRPLLFL DVDGPLNPYA AKPERRPDGY TTLRVPRNDE        60
     HQDDRRLTSR RPLRVWLNPE HGRFLLQLGF ELCWATTWMD DANRWIAPVL GLPELPFVDF       120
     GDVLLRERPD GVHWKTGPLV DYAGGRPFAW VDDEQSELDQ TFVAAHHQGA GLLHHVNPRI       180
     GLRKNDFHLL ADFARSLDTS RTTG                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page