(data stored in ACNUC7421 zone)

EMBL: AP009493.PE195

AP009493.PE195       Location/Qualifiers
FT   CDS             complement(199266..199601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_195"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17024"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNK1"
FT                   /protein_id="BAG17024.1"
FT                   /translation="MIIHSPRSTCDTRPKLAVQPRCEMSRASDSVGQQNHARRGLVTTN
FT                   QWTLSRPCCLSRIGGAPSRWTWRRYRRRTGAPAISSTGEATRSATGTRALAAASFAFSS
FT                   YRMRSVC"
     MIIHSPRSTC DTRPKLAVQP RCEMSRASDS VGQQNHARRG LVTTNQWTLS RPCCLSRIGG        60
     APSRWTWRRY RRRTGAPAIS STGEATRSAT GTRALAAASF AFSSYRMRSV C                111
//

If you have problems or comments...

PBIL Back to PBIL home page