(data stored in ACNUC7421 zone)

EMBL: AP009493.PE196

AP009493.PE196       Location/Qualifiers
FT   CDS             199852..200328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_196"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17025"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNK2"
FT                   /protein_id="BAG17025.1"
FT                   /translation="MGRQTASGTVRGWFVRSVSARATLAAAALFMSVSCAGAGATQGGS
FT                   GSSCAALLDYEGRTYLGHGLHPDDEGDGDGVRAGRRLGTGSVPGCDDTPNEGDQQATSK
FT                   PVTVYAIEGVDPVHAVTLDYPTGGTLYIEQASKKTLPELRKLIEAQELDDAATT"
     MGRQTASGTV RGWFVRSVSA RATLAAAALF MSVSCAGAGA TQGGSGSSCA ALLDYEGRTY        60
     LGHGLHPDDE GDGDGVRAGR RLGTGSVPGC DDTPNEGDQQ ATSKPVTVYA IEGVDPVHAV       120
     TLDYPTGGTL YIEQASKKTL PELRKLIEAQ ELDDAATT                               158
//

If you have problems or comments...

PBIL Back to PBIL home page