(data stored in ACNUC7421 zone)

EMBL: AP009493.PE197

AP009493.PE197       Location/Qualifiers
FT   CDS             complement(200565..201203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_197"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17026"
FT                   /db_xref="GOA:B1VNK3"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNK3"
FT                   /protein_id="BAG17026.1"
FT                   /translation="MRDVRVVLIGGTSNVGKSTVAQAVAERLGFACLSTDALARHPGRP
FT                   WRTSEGEVPAHVAEHYGSLTVNDLITSVLDHYDRLWPRIEELITTRAVEDRGSAGLVLE
FT                   GSALWPVRVARLQVPHTAAVWLSTDDSVVRSRVHAAGSYETATAAERILMDKFLARTER
FT                   YQALMIEAVGRLGLDRIDAGDGQSAGELADMVLAAVDAQTAPGRASNDR"
     MRDVRVVLIG GTSNVGKSTV AQAVAERLGF ACLSTDALAR HPGRPWRTSE GEVPAHVAEH        60
     YGSLTVNDLI TSVLDHYDRL WPRIEELITT RAVEDRGSAG LVLEGSALWP VRVARLQVPH       120
     TAAVWLSTDD SVVRSRVHAA GSYETATAAE RILMDKFLAR TERYQALMIE AVGRLGLDRI       180
     DAGDGQSAGE LADMVLAAVD AQTAPGRASN DR                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page