(data stored in ACNUC7421 zone)

EMBL: AP009493.PE198

AP009493.PE198       Location/Qualifiers
FT   CDS             201820..202455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_198"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17027"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNK4"
FT                   /protein_id="BAG17027.1"
FT                   /translation="MVYQNDAIKGECVNTEKLTARRLTAEETAELGPQDSVFVPASMDG
FT                   VSPDCYAPAFLTKPGKSFEGGSFIARTAFGEEVHVLPDNAEEGGIWIADKAGEAIEVLQ
FT                   SAGVLLNLALFVPGGNKESLESLYSAAREAFGAGVVQRWSEEVVEVPDVKVDLYEEPAR
FT                   GRKNANNQNRDRRALDIFPTRVRFLEPSEGWKFVVEPHKEIVDETPTI"
     MVYQNDAIKG ECVNTEKLTA RRLTAEETAE LGPQDSVFVP ASMDGVSPDC YAPAFLTKPG        60
     KSFEGGSFIA RTAFGEEVHV LPDNAEEGGI WIADKAGEAI EVLQSAGVLL NLALFVPGGN       120
     KESLESLYSA AREAFGAGVV QRWSEEVVEV PDVKVDLYEE PARGRKNANN QNRDRRALDI       180
     FPTRVRFLEP SEGWKFVVEP HKEIVDETPT I                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page