(data stored in ACNUC7421 zone)

EMBL: AP009493.PE199

AP009493.PE199       Location/Qualifiers
FT   CDS             203293..204375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_199"
FT                   /product="putative secreted cellulose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_199"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17028"
FT                   /db_xref="GOA:B1VNK5"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNK5"
FT                   /protein_id="BAG17028.1"
FT                   /translation="MARRKKLLTSLVAVLATLLGGIGLTLMGQDNAQAHGVTMTPGSRT
FT                   YLCMLDARTGTGALDPTNPACKAALDESGANALYNWFAVLDSNAGGRGAGYVPDGTLCS
FT                   AGDRSPYDFTGYNAPRSDWPRTHLTAGKTIQVKHSNWAAHPGSFRVYLSKPGYSPSTEL
FT                   GWDDLELIETVTDPPQSGGPGTDGGHYYWNLDLPSGRSGDAVMFIQWVRSDSQENFFSC
FT                   SDIVFDGGNGEVTGIRGSGGTPNPTPTPTPTPTDPHSGCMAVYSVANSWSGGFQGSVEV
FT                   MNHGTTAREGWAVRWKPGVGVTVGNTWNGALTTGPDGTVTVRNLAHNRTIAPEGSVTFG
FT                   FTATSTGNDFPVGSIGCVTP"
     MARRKKLLTS LVAVLATLLG GIGLTLMGQD NAQAHGVTMT PGSRTYLCML DARTGTGALD        60
     PTNPACKAAL DESGANALYN WFAVLDSNAG GRGAGYVPDG TLCSAGDRSP YDFTGYNAPR       120
     SDWPRTHLTA GKTIQVKHSN WAAHPGSFRV YLSKPGYSPS TELGWDDLEL IETVTDPPQS       180
     GGPGTDGGHY YWNLDLPSGR SGDAVMFIQW VRSDSQENFF SCSDIVFDGG NGEVTGIRGS       240
     GGTPNPTPTP TPTPTDPHSG CMAVYSVANS WSGGFQGSVE VMNHGTTARE GWAVRWKPGV       300
     GVTVGNTWNG ALTTGPDGTV TVRNLAHNRT IAPEGSVTFG FTATSTGNDF PVGSIGCVTP       360
//

If you have problems or comments...

PBIL Back to PBIL home page