(data stored in ACNUC7421 zone)

EMBL: AP009493.PE2

AP009493.PE2         Location/Qualifiers
FT   CDS             3401..3919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_2t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_2t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16831"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKK0"
FT                   /protein_id="BAG16831.1"
FT                   /translation="MTWQGGSAGSGAGTISSRAAPGVSTGLLQAPAICLPDFLLRRLLI
FT                   STVATMTLDDPTAKVREVMLVERPIGTRLSRSRTPGGNSALARDDDNSLVTHAVLYPTE
FT                   AFTAEEVVKIVGATAALAATAGIAVGAVAMKAGPRVKSTFSGLRSKLTLKAEEVTAAAA
FT                   EQVPEQPGT"
     MTWQGGSAGS GAGTISSRAA PGVSTGLLQA PAICLPDFLL RRLLISTVAT MTLDDPTAKV        60
     REVMLVERPI GTRLSRSRTP GGNSALARDD DNSLVTHAVL YPTEAFTAEE VVKIVGATAA       120
     LAATAGIAVG AVAMKAGPRV KSTFSGLRSK LTLKAEEVTA AAAEQVPEQP GT               172
//

If you have problems or comments...

PBIL Back to PBIL home page