(data stored in ACNUC7421 zone)

EMBL: AP009493.PE20

AP009493.PE20        Location/Qualifiers
FT   CDS             26949..27332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_20t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_20t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16849"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKM3"
FT                   /protein_id="BAG16849.1"
FT                   /translation="MKRLARELCAAMMRIRLGGGGRGHQMTRWQLLQGDVLVGELSEYG
FT                   CDQPFFLARFTPGPGWESVRPSFEALATYRGPDPDGLRFVALAKPLQDLGLTLAPVDGQ
FT                   QTPLQLFKDCMVRIYGAEARLRY"
     MKRLARELCA AMMRIRLGGG GRGHQMTRWQ LLQGDVLVGE LSEYGCDQPF FLARFTPGPG        60
     WESVRPSFEA LATYRGPDPD GLRFVALAKP LQDLGLTLAP VDGQQTPLQL FKDCMVRIYG       120
     AEARLRY                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page