(data stored in ACNUC7421 zone)

EMBL: AP009493.PE201

AP009493.PE201       Location/Qualifiers
FT   CDS             205971..207002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_201"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17030"
FT                   /db_xref="GOA:B1VNK7"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNK7"
FT                   /protein_id="BAG17030.1"
FT                   /translation="MTHTAAEAPRDERRRRAGGRGRRWGLSACGVALIAPAVLLVVRLT
FT                   GLDAGTPLAMPMVLFPWTTVIGVLVLLLLAAVPVLRSRWALVGTAALVTAHAVLLAPRF
FT                   LSDGPQVAEGAVELRVATINTNGGAADARAVVRLVRTERIDVLAVQQMPPGGVEALDRA
FT                   GLGALLPHQELHPEYDSSVYSRLPLGEAGTTRADTAWPQTVAEVAVGGRSVRFVAVHTY
FT                   YPLGSPERWTRDMAALTSLARRAGPDTVFLGDFNASLDHAPMRDLLAAGLTDTHAELGR
FT                   GWAPTWPVGLMLVPPVVQLDHVLHGSGLAGVSVGERTVPGTDHRAVVAVLALLPERAGE
FT                   RSR"
     MTHTAAEAPR DERRRRAGGR GRRWGLSACG VALIAPAVLL VVRLTGLDAG TPLAMPMVLF        60
     PWTTVIGVLV LLLLAAVPVL RSRWALVGTA ALVTAHAVLL APRFLSDGPQ VAEGAVELRV       120
     ATINTNGGAA DARAVVRLVR TERIDVLAVQ QMPPGGVEAL DRAGLGALLP HQELHPEYDS       180
     SVYSRLPLGE AGTTRADTAW PQTVAEVAVG GRSVRFVAVH TYYPLGSPER WTRDMAALTS       240
     LARRAGPDTV FLGDFNASLD HAPMRDLLAA GLTDTHAELG RGWAPTWPVG LMLVPPVVQL       300
     DHVLHGSGLA GVSVGERTVP GTDHRAVVAV LALLPERAGE RSR                         343
//

If you have problems or comments...

PBIL Back to PBIL home page