(data stored in ACNUC7421 zone)

EMBL: AP009493.PE205

AP009493.PE205       Location/Qualifiers
FT   CDS             complement(209967..211151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_205"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_205"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17034"
FT                   /db_xref="GOA:B1VNL1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017205"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNL1"
FT                   /protein_id="BAG17034.1"
FT                   /translation="MNQRPLPETASTVPSPHRWNAVLWVLLGVVPPAIAVADAPGTTRL
FT                   PVLGLLAVLALSYAAVGLFPGNPVLSPRPYLYVQVVGLGALSYLLDGGAALFVVTLPHF
FT                   WIYTASARAAIALSGLAAAAVVTGNVVRQGWDGEFFTGNVIFTLIGYAAGVLIGSGVRH
FT                   ITEDADERARRLRAELEEARLRLVEAHHRQGAADERERLAREIHDTLAQGFASIVVLAE
FT                   AARSGLATDPGTSGKHLLAIENTARENLAEARVLVGSAPQGGAATGSVADTLRRTLRRF
FT                   TEDTGTPVTSELPDVTCDQRTRIALLRCTQESLANIRKHAAASTVDVVLTAQPYGIELE
FT                   ITDDGTGFVTADSRGFGLHGMRGRLAELGGELTVTSSVGDGTRVLAMIPTDGQG"
     MNQRPLPETA STVPSPHRWN AVLWVLLGVV PPAIAVADAP GTTRLPVLGL LAVLALSYAA        60
     VGLFPGNPVL SPRPYLYVQV VGLGALSYLL DGGAALFVVT LPHFWIYTAS ARAAIALSGL       120
     AAAAVVTGNV VRQGWDGEFF TGNVIFTLIG YAAGVLIGSG VRHITEDADE RARRLRAELE       180
     EARLRLVEAH HRQGAADERE RLAREIHDTL AQGFASIVVL AEAARSGLAT DPGTSGKHLL       240
     AIENTARENL AEARVLVGSA PQGGAATGSV ADTLRRTLRR FTEDTGTPVT SELPDVTCDQ       300
     RTRIALLRCT QESLANIRKH AAASTVDVVL TAQPYGIELE ITDDGTGFVT ADSRGFGLHG       360
     MRGRLAELGG ELTVTSSVGD GTRVLAMIPT DGQG                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page