(data stored in ACNUC7421 zone)

EMBL: AP009493.PE206

AP009493.PE206       Location/Qualifiers
FT   CDS             complement(211148..213418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_206"
FT                   /product="putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_206"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17035"
FT                   /db_xref="GOA:B1VNL2"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNL2"
FT                   /protein_id="BAG17035.1"
FT                   /translation="MRHLPVRMARWSARHAGRAIAGWFTFVVLCLAAGLALGTNEATTR
FT                   DFWVGEAGRAEATATEGGLERSPTERIMIRAGAGELDMAAAGAAARDVTRRMRDLPEVE
FT                   SVAAPVRSKDGKVLLVSVVLNGPELEGKKNVVPLLEQTAAVAADHPDLVVEETGSPAIS
FT                   KGVNDQRDEDLALSERVSLPVTAITLLVVFGSVIMAGVPLLLALSSIAAAIGLSMAASH
FT                   LMPDAGVGTNLILLIGLAVGVDYTLFYLKREREEQARAGGRLGPEARVELAAATAGRAI
FT                   VVSGLAVIVSTATLYLATDVIFSSLATGTVLVVAVAVASSLTVLPALLVVIGRRADRLA
FT                   PRRAARRARSGRPPRAEKPETGRVFGALLRPARTRPALTLCLSVLVMLGLAVPALGLKL
FT                   IDPGRDTFSRDIPAMRVYDRLTESFPELLVTHEVVTRSTPERAAQVRRALEDLGRRAQA
FT                   DPLFAQPPRNGYEANDSEGATSPTDPAAPGPTVRTSADGRVSVLELPVPHPAPSAEAIA
FT                   SLTHLRQDHIPATVGRLPGVETAVSGDVARGRDYVSHESDRLPLVLGSLLLMTFLMTVW
FT                   AFRSVVIGAIGVVLNLLSAGASLGMLVLVFQGTWAEGLLAFDSLGAIASRVPLFLVVIL
FT                   FGLSMDYQVFVVSRIQEARQNGMSARDAVLEGINRSAKVVTSAAIVMVTVFGAFVALHL
FT                   TEMKQMGFCLAVAVLLDAVVIRLLVLPSVLLLLGERAWWPARRPGRSPEPAAGPRTESR
FT                   LTR"
     MRHLPVRMAR WSARHAGRAI AGWFTFVVLC LAAGLALGTN EATTRDFWVG EAGRAEATAT        60
     EGGLERSPTE RIMIRAGAGE LDMAAAGAAA RDVTRRMRDL PEVESVAAPV RSKDGKVLLV       120
     SVVLNGPELE GKKNVVPLLE QTAAVAADHP DLVVEETGSP AISKGVNDQR DEDLALSERV       180
     SLPVTAITLL VVFGSVIMAG VPLLLALSSI AAAIGLSMAA SHLMPDAGVG TNLILLIGLA       240
     VGVDYTLFYL KREREEQARA GGRLGPEARV ELAAATAGRA IVVSGLAVIV STATLYLATD       300
     VIFSSLATGT VLVVAVAVAS SLTVLPALLV VIGRRADRLA PRRAARRARS GRPPRAEKPE       360
     TGRVFGALLR PARTRPALTL CLSVLVMLGL AVPALGLKLI DPGRDTFSRD IPAMRVYDRL       420
     TESFPELLVT HEVVTRSTPE RAAQVRRALE DLGRRAQADP LFAQPPRNGY EANDSEGATS       480
     PTDPAAPGPT VRTSADGRVS VLELPVPHPA PSAEAIASLT HLRQDHIPAT VGRLPGVETA       540
     VSGDVARGRD YVSHESDRLP LVLGSLLLMT FLMTVWAFRS VVIGAIGVVL NLLSAGASLG       600
     MLVLVFQGTW AEGLLAFDSL GAIASRVPLF LVVILFGLSM DYQVFVVSRI QEARQNGMSA       660
     RDAVLEGINR SAKVVTSAAI VMVTVFGAFV ALHLTEMKQM GFCLAVAVLL DAVVIRLLVL       720
     PSVLLLLGER AWWPARRPGR SPEPAAGPRT ESRLTR                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page