(data stored in ACNUC7421 zone)

EMBL: AP009493.PE210

AP009493.PE210       Location/Qualifiers
FT   CDS             217276..218208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_210"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_210"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17039"
FT                   /db_xref="GOA:B1VNL6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNL6"
FT                   /protein_id="BAG17039.1"
FT                   /translation="MAPTAAVATPPPEKSRRRRARPRRLPYLLIAPAGLLMLGFIAYPV
FT                   LSVFSYSLQHYNVTKPWRNGFAGLDNFRRVFTEDDQFWPTLAFSAQWVFTQVTLQLLLG
FT                   LALALIVNQTFIGRGISRAMVFSPWAVSGVLTSTIWILLYNSSTGFSRYLADAGIGEYG
FT                   TSVLSDTGTVFWAATVTELWRGVPFFAILILADLQSVSKELYEAASVDGAGRLRQFFHI
FT                   TLPHLRDAIILATLLRGVWEFNNVDLLYTLTGGGPAGETTTLPLYVANTGIEGHDFGYA
FT                   SALTTVAFVILLFCSIVYLRLSKFGGDRT"
     MAPTAAVATP PPEKSRRRRA RPRRLPYLLI APAGLLMLGF IAYPVLSVFS YSLQHYNVTK        60
     PWRNGFAGLD NFRRVFTEDD QFWPTLAFSA QWVFTQVTLQ LLLGLALALI VNQTFIGRGI       120
     SRAMVFSPWA VSGVLTSTIW ILLYNSSTGF SRYLADAGIG EYGTSVLSDT GTVFWAATVT       180
     ELWRGVPFFA ILILADLQSV SKELYEAASV DGAGRLRQFF HITLPHLRDA IILATLLRGV       240
     WEFNNVDLLY TLTGGGPAGE TTTLPLYVAN TGIEGHDFGY ASALTTVAFV ILLFCSIVYL       300
     RLSKFGGDRT                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page