(data stored in ACNUC7421 zone)

EMBL: AP009493.PE211

AP009493.PE211       Location/Qualifiers
FT   CDS             218205..219116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_211"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_211"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17040"
FT                   /db_xref="GOA:B1VNL7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNL7"
FT                   /protein_id="BAG17040.1"
FT                   /translation="MTALLTERNGTAPRSTAPGSPPSARRRRPGRERAFDDVPRWQIYL
FT                   PLGLYLLFTLVPFYWMLLFAVRPAGSTSLAPWPMTGAHFSKVWNERSFAVFFQNSMIVG
FT                   VATLVATTLVALAGGYALARFDFRIKGAFMLALLCSQFIPGALMLVPLFEIFRNLQMIN
FT                   SLGSVVIAETVFQLPLSIILISGFIKNVPVSLEEAAWVDGCSRFTAFRTVVLPLLRPGL
FT                   IAVGSFAFVHSWNHFLFALMFLSEQDKQTIPVGLNTLIGADSVDLGALAAGGVIAAVPV
FT                   VVVFAFIQKWLITGFSAGAVKG"
     MTALLTERNG TAPRSTAPGS PPSARRRRPG RERAFDDVPR WQIYLPLGLY LLFTLVPFYW        60
     MLLFAVRPAG STSLAPWPMT GAHFSKVWNE RSFAVFFQNS MIVGVATLVA TTLVALAGGY       120
     ALARFDFRIK GAFMLALLCS QFIPGALMLV PLFEIFRNLQ MINSLGSVVI AETVFQLPLS       180
     IILISGFIKN VPVSLEEAAW VDGCSRFTAF RTVVLPLLRP GLIAVGSFAF VHSWNHFLFA       240
     LMFLSEQDKQ TIPVGLNTLI GADSVDLGAL AAGGVIAAVP VVVVFAFIQK WLITGFSAGA       300
     VKG                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page