(data stored in ACNUC7421 zone)

EMBL: AP009493.PE213

AP009493.PE213       Location/Qualifiers
FT   CDS             220330..221184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_213"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17042"
FT                   /db_xref="InterPro:IPR029475"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNL9"
FT                   /protein_id="BAG17042.1"
FT                   /translation="MNQRPGAPFPDLPATLACDGRTVAHYGYAPGADGRPRLHPVTTLG
FT                   GTAVTEDRPADHLHHLGVSVAVPDVAGYNFWGGHTFVRGKGPTALDNHGVQRHLARPQR
FT                   SPNGFTQELGWEAAGVELLREHRTLSATRTSDASWELDFSFVLTNTGGEELSLGSPATN
FT                   GRPGAGYGGFFWRAPKEAAPPTVFSATGEGESEVHGRTADWLALSGAGWTLVFVGATAR
FT                   TRRDPWFVRTSAYPGVGSSLAAHERLPVPAGSSVVRRIITVVVDGRPDRETAARYAREA
FT                   VAR"
     MNQRPGAPFP DLPATLACDG RTVAHYGYAP GADGRPRLHP VTTLGGTAVT EDRPADHLHH        60
     LGVSVAVPDV AGYNFWGGHT FVRGKGPTAL DNHGVQRHLA RPQRSPNGFT QELGWEAAGV       120
     ELLREHRTLS ATRTSDASWE LDFSFVLTNT GGEELSLGSP ATNGRPGAGY GGFFWRAPKE       180
     AAPPTVFSAT GEGESEVHGR TADWLALSGA GWTLVFVGAT ARTRRDPWFV RTSAYPGVGS       240
     SLAAHERLPV PAGSSVVRRI ITVVVDGRPD RETAARYARE AVAR                        284
//

If you have problems or comments...

PBIL Back to PBIL home page