(data stored in ACNUC7421 zone)

EMBL: AP009493.PE215

AP009493.PE215       Location/Qualifiers
FT   CDS             222779..224113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_215"
FT                   /product="putative secreted sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_215"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17044"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNM1"
FT                   /protein_id="BAG17044.1"
FT                   /translation="MTISTTQRGRATAAVSVAAVLALTATACGDDGSGSGTEGSGKGEI
FT                   TFWDNNGGPRTAVWTEIIEDFEKQHPDIDVTYVPIPIADVQSKYDTAIAGGGLPDVGGV
FT                   GTAYLANMVSQEALEPVNDRLEKSALRGKLVESMVESVRAAAGRGDDVYSVPTSANNGV
FT                   LWYRTDLFERAGLKAPDTWANFYTAAEKLTDAKKNEFGYTIRGGAGSIAQALDAVYGQS
FT                   GITEFWDGDTTTLNDPKNVAALEKYAGLFKRTTPAADVNNDFTKMVAQWDTGTIGMLSH
FT                   NLGSYQDHLKALGEDKFAGIPAPIGEGGTRVQVSNPVDGLGLFRSSRNKTAAWKFIEFA
FT                   ASHASNSKWNESAGAIPANAEAAKDPWINETESTALAAKTLTDGSTKIVDLPYYLPDWN
FT                   NISKADNEPEFQKVLLGKITAKAFLDDMAEQLNAANKEWKELGNG"
     MTISTTQRGR ATAAVSVAAV LALTATACGD DGSGSGTEGS GKGEITFWDN NGGPRTAVWT        60
     EIIEDFEKQH PDIDVTYVPI PIADVQSKYD TAIAGGGLPD VGGVGTAYLA NMVSQEALEP       120
     VNDRLEKSAL RGKLVESMVE SVRAAAGRGD DVYSVPTSAN NGVLWYRTDL FERAGLKAPD       180
     TWANFYTAAE KLTDAKKNEF GYTIRGGAGS IAQALDAVYG QSGITEFWDG DTTTLNDPKN       240
     VAALEKYAGL FKRTTPAADV NNDFTKMVAQ WDTGTIGMLS HNLGSYQDHL KALGEDKFAG       300
     IPAPIGEGGT RVQVSNPVDG LGLFRSSRNK TAAWKFIEFA ASHASNSKWN ESAGAIPANA       360
     EAAKDPWINE TESTALAAKT LTDGSTKIVD LPYYLPDWNN ISKADNEPEF QKVLLGKITA       420
     KAFLDDMAEQ LNAANKEWKE LGNG                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page