(data stored in ACNUC7421 zone)

EMBL: AP009493.PE219

AP009493.PE219       Location/Qualifiers
FT   CDS             228493..229362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_219"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17048"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNM5"
FT                   /protein_id="BAG17048.1"
FT                   /translation="MVTGATGVLGRRVVDGLLGAGRPVRAVSRRPRRGALPPAVEAAVG
FT                   DVNEPSTLRTAFEGAGALVLVAVPDTAVEVVAYARAAGIEHIVVVSSAAVTAGHDTTYN
FT                   LPVERAVRESGLDWSIVRPGEFATNALLIWGPSIRSGRRVVEPFPDQSGSPIHEQDIAD
FT                   VIVADLLDPGRRGRIDTIVGPDALTKRDQVARIAEAVGVEIALDEVTPERALAFYREQG
FT                   GFAADNADWLYGFTSYDGVEGVTDEHREVDPGSDDAYLTLAEVLGRPGRSYAQWARDHA
FT                   GDFTGAAR"
     MVTGATGVLG RRVVDGLLGA GRPVRAVSRR PRRGALPPAV EAAVGDVNEP STLRTAFEGA        60
     GALVLVAVPD TAVEVVAYAR AAGIEHIVVV SSAAVTAGHD TTYNLPVERA VRESGLDWSI       120
     VRPGEFATNA LLIWGPSIRS GRRVVEPFPD QSGSPIHEQD IADVIVADLL DPGRRGRIDT       180
     IVGPDALTKR DQVARIAEAV GVEIALDEVT PERALAFYRE QGGFAADNAD WLYGFTSYDG       240
     VEGVTDEHRE VDPGSDDAYL TLAEVLGRPG RSYAQWARDH AGDFTGAAR                   289
//

If you have problems or comments...

PBIL Back to PBIL home page