(data stored in ACNUC7421 zone)

EMBL: AP009493.PE220

AP009493.PE220       Location/Qualifiers
FT   CDS             complement(229492..230964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_220"
FT                   /product="putative sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_220"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17049"
FT                   /db_xref="GOA:B1VNM6"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNM6"
FT                   /protein_id="BAG17049.1"
FT                   /translation="MSSASRHPTPHAPAVIGIDVATASVRVVCVDGRGCVLAEARAELP
FT                   PPVRTVAGTSEQDARSWWPAVRTALRRTTGALPRGGREVTAVAVSATSGTIVPTGADGV
FT                   PLGPALMYDDRRAADLNAEAQRVGGARWDALGLSVGPTAALGRAVWCLRTYGRGLRHVL
FT                   HTPDLVGRALTGRPVATDWSHALKSGYDARAAEWAHEVFDAFDFPLALLPAVRAPATEA
FT                   GVVGREAAEATGLPEGCSVRLGMTDGCAGQIATGAVEPGRFVGVLGTTYVLKGVSAELV
FT                   HDATGAVYSHRHPDGWWLPGGASNTGGEWLADVDPARLPALDAAAAARGPASYVRYPLR
FT                   RDGERFPFVSGAARGFELGRPRDEADAHRAALEGVAFVERLALERVERLGVPVLGPLHA
FT                   AGGGSRSAVWTAIRATVLDRPVRVVDRAETAFGAALLAATGTLHEDLAAGAAAMVRGGA
FT                   LVDPVPGERSALDDAHGRFVAALRERGWISDG"
     MSSASRHPTP HAPAVIGIDV ATASVRVVCV DGRGCVLAEA RAELPPPVRT VAGTSEQDAR        60
     SWWPAVRTAL RRTTGALPRG GREVTAVAVS ATSGTIVPTG ADGVPLGPAL MYDDRRAADL       120
     NAEAQRVGGA RWDALGLSVG PTAALGRAVW CLRTYGRGLR HVLHTPDLVG RALTGRPVAT       180
     DWSHALKSGY DARAAEWAHE VFDAFDFPLA LLPAVRAPAT EAGVVGREAA EATGLPEGCS       240
     VRLGMTDGCA GQIATGAVEP GRFVGVLGTT YVLKGVSAEL VHDATGAVYS HRHPDGWWLP       300
     GGASNTGGEW LADVDPARLP ALDAAAAARG PASYVRYPLR RDGERFPFVS GAARGFELGR       360
     PRDEADAHRA ALEGVAFVER LALERVERLG VPVLGPLHAA GGGSRSAVWT AIRATVLDRP       420
     VRVVDRAETA FGAALLAATG TLHEDLAAGA AAMVRGGALV DPVPGERSAL DDAHGRFVAA       480
     LRERGWISDG                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page