(data stored in ACNUC7421 zone)

EMBL: AP009493.PE224

AP009493.PE224       Location/Qualifiers
FT   CDS             233877..235349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_224"
FT                   /product="putative sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_224"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17053"
FT                   /db_xref="GOA:B1VNN0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNN0"
FT                   /protein_id="BAG17053.1"
FT                   /translation="MSTIIGVDIGTSVTKAVAYDGAGGALASASRRSRLDMLPGGRVEQ
FT                   DLDDVVAGVGDVVREVAAAVGRTPDAVALTGQGDGLWLRDSGGLPVRPAISWMDGRAAE
FT                   LVTRWLVDGTISTAFAHTGSGMFPGCHGPLLNWLQEHEPDALDRAAVAGYCVDAVAQRL
FT                   TGRVCLDASDATLPFLDPRTRRYAPQALAACGIGDRAGLLPSPAAPGTVLALDGRGAGL
FT                   LGLPEGLPVVAGPYDLPACAIGSGVREVGDGVLILGTTLASQVLTDRVDLDPLAEPAGM
FT                   WLCTPSPGRWLRAMPAMVGTAALEWVLALVGATTADVDALLTDSPPGARGVHAFPFLSE
FT                   AGERAPFVDPSAQGRLDGLSLATGREDAVRAVCEAIGYAARHCLDTAGLSGTLALCGGG
FT                   TRSVLWARLIADVLGRPVRVPLEEQVGALGVVSVARSSLSPGYEAPPGRHRVVEPREGV
FT                   RALYEDGYERYRAELATARAAWGARARLSRRP"
     MSTIIGVDIG TSVTKAVAYD GAGGALASAS RRSRLDMLPG GRVEQDLDDV VAGVGDVVRE        60
     VAAAVGRTPD AVALTGQGDG LWLRDSGGLP VRPAISWMDG RAAELVTRWL VDGTISTAFA       120
     HTGSGMFPGC HGPLLNWLQE HEPDALDRAA VAGYCVDAVA QRLTGRVCLD ASDATLPFLD       180
     PRTRRYAPQA LAACGIGDRA GLLPSPAAPG TVLALDGRGA GLLGLPEGLP VVAGPYDLPA       240
     CAIGSGVREV GDGVLILGTT LASQVLTDRV DLDPLAEPAG MWLCTPSPGR WLRAMPAMVG       300
     TAALEWVLAL VGATTADVDA LLTDSPPGAR GVHAFPFLSE AGERAPFVDP SAQGRLDGLS       360
     LATGREDAVR AVCEAIGYAA RHCLDTAGLS GTLALCGGGT RSVLWARLIA DVLGRPVRVP       420
     LEEQVGALGV VSVARSSLSP GYEAPPGRHR VVEPREGVRA LYEDGYERYR AELATARAAW       480
     GARARLSRRP                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page