(data stored in ACNUC7421 zone)

EMBL: AP009493.PE225

AP009493.PE225       Location/Qualifiers
FT   CDS             235459..236538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_225"
FT                   /product="putative sugar ABC transporter sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_225"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17054"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNN1"
FT                   /protein_id="BAG17054.1"
FT                   /translation="MKQRSVRSFAAVLSAMAVTVSAAACTTKAPTGSGGRSSEDAKIAF
FT                   LMPDIASTRYELYDAPLFKAKVKDLCGGCEVLYQNAGGDAAKQQQQADSALAQGADVIV
FT                   IDPVDSAAAAGTVRTAQGRGVPVIAYDRPIPAVEADYYVSFDNEKIGSMIGASLVEHLR
FT                   ATSAEGGLLQVNGSPTDAAAGLIKKGVHSAVDSSGFDLLAEYDTPAWEPGKAQSWVSGQ
FT                   IAKFRGRIAGVVAANDGTGGGSIAAFKAAGAAVPPVTGNDAELAAAQRIIKGDQYNTIS
FT                   KPIKTVAEAAADAAYAFARGEKPRGETELFGTPAQLFTPTVVTRENIAEVLVGDGKPLK
FT                   TAEVCTRTYAAACAEVGLA"
     MKQRSVRSFA AVLSAMAVTV SAAACTTKAP TGSGGRSSED AKIAFLMPDI ASTRYELYDA        60
     PLFKAKVKDL CGGCEVLYQN AGGDAAKQQQ QADSALAQGA DVIVIDPVDS AAAAGTVRTA       120
     QGRGVPVIAY DRPIPAVEAD YYVSFDNEKI GSMIGASLVE HLRATSAEGG LLQVNGSPTD       180
     AAAGLIKKGV HSAVDSSGFD LLAEYDTPAW EPGKAQSWVS GQIAKFRGRI AGVVAANDGT       240
     GGGSIAAFKA AGAAVPPVTG NDAELAAAQR IIKGDQYNTI SKPIKTVAEA AADAAYAFAR       300
     GEKPRGETEL FGTPAQLFTP TVVTRENIAE VLVGDGKPLK TAEVCTRTYA AACAEVGLA        359
//

If you have problems or comments...

PBIL Back to PBIL home page