(data stored in ACNUC7421 zone)

EMBL: AP009493.PE23

AP009493.PE23        Location/Qualifiers
FT   CDS             complement(28385..29173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_23t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_23t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16852"
FT                   /db_xref="GOA:B1VKM6"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKM6"
FT                   /protein_id="BAG16852.1"
FT                   /translation="MVQEEIEADPQLRRQLQLQLTAPGTNATGSLLITDSQVSRSTIAL
FT                   GPLTINNTRSGRAVIALVAALLLALVVLAVYGGTRLIMVDDSPKSSQDYSARHAVRTLD
FT                   VSEVKRVVPDLTSMPSGWERSGSLEAGKDEETGCSGAQERFSTNNWNDGSTRTVWAEFT
FT                   VQSCPSAALTAKGFEETRSGVANNNKASEISLPELGDQRAAITHYNADLDETTAVALVR
FT                   VGTVLVELEYDPVPDDPGWSREFGQLASMVAARAQQVQNA"
     MVQEEIEADP QLRRQLQLQL TAPGTNATGS LLITDSQVSR STIALGPLTI NNTRSGRAVI        60
     ALVAALLLAL VVLAVYGGTR LIMVDDSPKS SQDYSARHAV RTLDVSEVKR VVPDLTSMPS       120
     GWERSGSLEA GKDEETGCSG AQERFSTNNW NDGSTRTVWA EFTVQSCPSA ALTAKGFEET       180
     RSGVANNNKA SEISLPELGD QRAAITHYNA DLDETTAVAL VRVGTVLVEL EYDPVPDDPG       240
     WSREFGQLAS MVAARAQQVQ NA                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page