(data stored in ACNUC7421 zone)

EMBL: AP009493.PE230

AP009493.PE230       Location/Qualifiers
FT   CDS             complement(241418..241924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_230"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17059"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNN6"
FT                   /protein_id="BAG17059.1"
FT                   /translation="MRSHAPDAAEPALRADGAPFTTRPSGKKMVVMTDFIREGRLFRVI
FT                   GFLPSHRQLFLASEATLVDRTTTRVEVSFGHVELMFLKPFYRNGLHIRRATEAEFGLLG
FT                   ERHGIPAEDAAYTWMLERDGDSFVVAGRPSWREAEYALMGERESLYDPREPWPPDFPAE
FT                   SGQVG"
     MRSHAPDAAE PALRADGAPF TTRPSGKKMV VMTDFIREGR LFRVIGFLPS HRQLFLASEA        60
     TLVDRTTTRV EVSFGHVELM FLKPFYRNGL HIRRATEAEF GLLGERHGIP AEDAAYTWML       120
     ERDGDSFVVA GRPSWREAEY ALMGERESLY DPREPWPPDF PAESGQVG                    168
//

If you have problems or comments...

PBIL Back to PBIL home page