(data stored in ACNUC7421 zone)

EMBL: AP009493.PE231

AP009493.PE231       Location/Qualifiers
FT   CDS             complement(242028..249323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_231"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17060"
FT                   /db_xref="InterPro:IPR029112"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNN7"
FT                   /protein_id="BAG17060.1"
FT                   /translation="MIQAVPAVADPPAEEDTGVSRNSIGEDPRRDRCLAGVALHVGGPR
FT                   MKAKAIEALTGTDEQLREAIGDIGWIGYGPIGMEGIADKEDGSAYREAGDRRRAELNEA
FT                   NKPYRESAWTDEGMDFHAPDFGANVSYFTALAQVQLASPLGWDGHSEASDEAIARARVI
FT                   ADENDGKDDWHDFAAHLMLRDVGYEYSGGTTSSDIAAYLRRGGFATDAPVKDTAEYNVE
FT                   VEDLKQAWAACDYQNPIDPRRVLNAPVMTAMVDWELEYAGQADQRATIIQAEADAAAAT
FT                   QAATGDMIEAIRQAWIVEQILTWRKYWQDAAANGIDMSDKPDQAFYDKATADQNAARTK
FT                   VAALVVSAKAQAAKAATAAQKAATAQQEAWAVADAARTPRGRGLMYAQQSVQVARASAA
FT                   ATAAAAKATETALAAANATIADADALLAKAQTDSHAISTEFRRVAAEEAASQAKAAADS
FT                   AEANAQGAAASAKRAKDARTTAEQKRDKAEDAATTAASERAKAQAEKANAVASRAEAAI
FT                   EREKAQKAQQRAATEQTTAKSADTAAETASADATAKRKLATEKAKAAQTAREKAVAATQ
FT                   AKQATAARAAALEAAATAAAGTAAAAETRAAATAARTAASQAAQASTAAQTAADQATTA
FT                   AVGARSAATTAEGAARRAEANAGKAWSAYRTSLGAASSAHAAAAVALDASQDAALRAEN
FT                   AATASQNATKLAEKAEQESAAAVTSAADAVKSAATVVGRAYAAGQAALAARDSAKEATA
FT                   ASSEAIAAGTPYRVKDSSAAFAVLVGQSSKTIAEQQAAAAEAKATEAAAASDSARQAAA
FT                   QATGDAKLAAEAAARAASDSVRAVEAVTRAQTSAADAAGDQKGAKKASDAAAGHSQQAG
FT                   DDAAKAQLVANETNTTAIEADREATDAERHAAEANEKADRAGEAAKGAQDKATEAEKEA
FT                   KAAEDKASDATGDSTAAEEAAKKAEQEQREKNEAAHKDALAEGVTPIKGGAANWPVLGD
FT                   REEKILLDACGRTCVDDYREGLAAVSVDIVAWATANGGQILFEQLDAADVKQCLAGYDV
FT                   EDCLWDLVDITSSAVIVGRMPALAQAVEKVSEGVRKIFVDADNAQRRLGELTAVISDVR
FT                   STPRLNRCLAGVALHAGGAKMKAKAIEGLTGTNDQLDAVIGDVGWIGFMPLGQARDQDS
FT                   EAAMAFRDAMAAREALLEDANRPYAMSSFDDGITLHTPEFGEDILGFTLASQAKLSQRL
FT                   GWDDHTNASAEALAKAGEITEQNRGKDSWHDAEADVMLRYSNVSNTRFSGGTTSADVAT
FT                   YLRHGGFLGKKVTEDSAGFRIEVETLKQAWAECNHQDPVDPRNGLSEVVSQASAEWETE
FT                   YAGQAAPRAVIMQAEADAAAATRAAADTMVEAIGQAWFADQILRWQKYWQDQLKIDPDH
FT                   LFKPKQALFDRAKSDLAKARGKVQVLVTASKQQAAAANAAAQRAVTAQQQAWTIADAAE
FT                   VPRGRGLVYAQQSVQVARASGAAATAAAKATETALNAANATVSTSHALLALAQTQTHAV
FT                   KTEFARIAAQEAASQAKVAADSAEAYAASAAANAATAKKAKETAAAEEEEARQAAADAQ
FT                   RSRGVAELERANAAAYRATAESERDKAAGHEADAVAQGRLAGDARTSAEASAATASDRR
FT                   ANAEKAEKDAVAARDKALEAEQRRDSLKAKAAAKEAHAAAMEGTDAAEAARAAATDARS
FT                   AANTATTAATNARASANAATAAATNAREAATKAQGAASRAKAASDATWASYLVAAGSAA
FT                   SAHAAAAEAIDASEAAALDAKGAKEQSEKASTAARTAKKEAATAHSEALKTAAWAATTA
FT                   GKALAAVQSSLAARDSAAAVIKPANEAISLGGPYQETDSSAAFAVLTGQQSLTLSQQQA
FT                   AAAAATATLAEGFSAEAKALAAQAAADMKLAAQASAAAATDAVRAAKAYTRAQSSAAQA
FT                   AADSKLAQASAKRADGYAESAGQDVARAWTASNDAQLDAIAADSAATEAEKDAASARAA
FT                   ATRAEEDAAGARGAATRAEADATAAEKAAEGAWDAANEAQEAADRTEKGGNTEQITQGV
FT                   TTGISGVWAVLDRIEYIGEPRNVVKDNCNPIIHVGDCTITSDVTYKSHVDLFMCMATPD
FT                   SYSGSCPAADTVYLGPEVSEPTTKRLSYTLTMVEFNSGIDPVDVLLGDFIGCAKLITPG
FT                   VSGGSWGDCAWAASWFVAGVIFRSAKAAVTAMDAAMRTGIGFMDAYRALRTIGLTEAAV
FT                   QGIISRLLRMAAEACETVNTPKTFKVAAFSLASADSEVVKKCAALLKDLVKDGDHIVLG
FT                   INPHSDDLAASIGASTFNNKAYGTNLPAAMGLGERPIWTVGVERSVENPKVRISVTLDG
FT                   VAGAKNADEALTLLLQRGETIEKSDWKVIRTGGFGTAWEMIKLRTALRMEYRKWDSIEW
FT                   HMTNSKGDVVRVYPTRMTYANGTPVD"
     MIQAVPAVAD PPAEEDTGVS RNSIGEDPRR DRCLAGVALH VGGPRMKAKA IEALTGTDEQ        60
     LREAIGDIGW IGYGPIGMEG IADKEDGSAY REAGDRRRAE LNEANKPYRE SAWTDEGMDF       120
     HAPDFGANVS YFTALAQVQL ASPLGWDGHS EASDEAIARA RVIADENDGK DDWHDFAAHL       180
     MLRDVGYEYS GGTTSSDIAA YLRRGGFATD APVKDTAEYN VEVEDLKQAW AACDYQNPID       240
     PRRVLNAPVM TAMVDWELEY AGQADQRATI IQAEADAAAA TQAATGDMIE AIRQAWIVEQ       300
     ILTWRKYWQD AAANGIDMSD KPDQAFYDKA TADQNAARTK VAALVVSAKA QAAKAATAAQ       360
     KAATAQQEAW AVADAARTPR GRGLMYAQQS VQVARASAAA TAAAAKATET ALAAANATIA       420
     DADALLAKAQ TDSHAISTEF RRVAAEEAAS QAKAAADSAE ANAQGAAASA KRAKDARTTA       480
     EQKRDKAEDA ATTAASERAK AQAEKANAVA SRAEAAIERE KAQKAQQRAA TEQTTAKSAD       540
     TAAETASADA TAKRKLATEK AKAAQTAREK AVAATQAKQA TAARAAALEA AATAAAGTAA       600
     AAETRAAATA ARTAASQAAQ ASTAAQTAAD QATTAAVGAR SAATTAEGAA RRAEANAGKA       660
     WSAYRTSLGA ASSAHAAAAV ALDASQDAAL RAENAATASQ NATKLAEKAE QESAAAVTSA       720
     ADAVKSAATV VGRAYAAGQA ALAARDSAKE ATAASSEAIA AGTPYRVKDS SAAFAVLVGQ       780
     SSKTIAEQQA AAAEAKATEA AAASDSARQA AAQATGDAKL AAEAAARAAS DSVRAVEAVT       840
     RAQTSAADAA GDQKGAKKAS DAAAGHSQQA GDDAAKAQLV ANETNTTAIE ADREATDAER       900
     HAAEANEKAD RAGEAAKGAQ DKATEAEKEA KAAEDKASDA TGDSTAAEEA AKKAEQEQRE       960
     KNEAAHKDAL AEGVTPIKGG AANWPVLGDR EEKILLDACG RTCVDDYREG LAAVSVDIVA      1020
     WATANGGQIL FEQLDAADVK QCLAGYDVED CLWDLVDITS SAVIVGRMPA LAQAVEKVSE      1080
     GVRKIFVDAD NAQRRLGELT AVISDVRSTP RLNRCLAGVA LHAGGAKMKA KAIEGLTGTN      1140
     DQLDAVIGDV GWIGFMPLGQ ARDQDSEAAM AFRDAMAARE ALLEDANRPY AMSSFDDGIT      1200
     LHTPEFGEDI LGFTLASQAK LSQRLGWDDH TNASAEALAK AGEITEQNRG KDSWHDAEAD      1260
     VMLRYSNVSN TRFSGGTTSA DVATYLRHGG FLGKKVTEDS AGFRIEVETL KQAWAECNHQ      1320
     DPVDPRNGLS EVVSQASAEW ETEYAGQAAP RAVIMQAEAD AAAATRAAAD TMVEAIGQAW      1380
     FADQILRWQK YWQDQLKIDP DHLFKPKQAL FDRAKSDLAK ARGKVQVLVT ASKQQAAAAN      1440
     AAAQRAVTAQ QQAWTIADAA EVPRGRGLVY AQQSVQVARA SGAAATAAAK ATETALNAAN      1500
     ATVSTSHALL ALAQTQTHAV KTEFARIAAQ EAASQAKVAA DSAEAYAASA AANAATAKKA      1560
     KETAAAEEEE ARQAAADAQR SRGVAELERA NAAAYRATAE SERDKAAGHE ADAVAQGRLA      1620
     GDARTSAEAS AATASDRRAN AEKAEKDAVA ARDKALEAEQ RRDSLKAKAA AKEAHAAAME      1680
     GTDAAEAARA AATDARSAAN TATTAATNAR ASANAATAAA TNAREAATKA QGAASRAKAA      1740
     SDATWASYLV AAGSAASAHA AAAEAIDASE AAALDAKGAK EQSEKASTAA RTAKKEAATA      1800
     HSEALKTAAW AATTAGKALA AVQSSLAARD SAAAVIKPAN EAISLGGPYQ ETDSSAAFAV      1860
     LTGQQSLTLS QQQAAAAAAT ATLAEGFSAE AKALAAQAAA DMKLAAQASA AAATDAVRAA      1920
     KAYTRAQSSA AQAAADSKLA QASAKRADGY AESAGQDVAR AWTASNDAQL DAIAADSAAT      1980
     EAEKDAASAR AAATRAEEDA AGARGAATRA EADATAAEKA AEGAWDAANE AQEAADRTEK      2040
     GGNTEQITQG VTTGISGVWA VLDRIEYIGE PRNVVKDNCN PIIHVGDCTI TSDVTYKSHV      2100
     DLFMCMATPD SYSGSCPAAD TVYLGPEVSE PTTKRLSYTL TMVEFNSGID PVDVLLGDFI      2160
     GCAKLITPGV SGGSWGDCAW AASWFVAGVI FRSAKAAVTA MDAAMRTGIG FMDAYRALRT      2220
     IGLTEAAVQG IISRLLRMAA EACETVNTPK TFKVAAFSLA SADSEVVKKC AALLKDLVKD      2280
     GDHIVLGINP HSDDLAASIG ASTFNNKAYG TNLPAAMGLG ERPIWTVGVE RSVENPKVRI      2340
     SVTLDGVAGA KNADEALTLL LQRGETIEKS DWKVIRTGGF GTAWEMIKLR TALRMEYRKW      2400
     DSIEWHMTNS KGDVVRVYPT RMTYANGTPV D                                     2431
//

If you have problems or comments...

PBIL Back to PBIL home page