(data stored in ACNUC7421 zone)

EMBL: AP009493.PE232

AP009493.PE232       Location/Qualifiers
FT   CDS             complement(249846..250583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_232"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17061"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNN8"
FT                   /protein_id="BAG17061.1"
FT                   /translation="MVPPESAVPADQSGNQCRRAPTGLRCHVSRRVRGAVDVANGLRWI
FT                   STAYDLGYTFTLCEGIGPRDLLARMGAEPHHLHELSDDVVAELQMRPEDGHLSDLDFLD
FT                   REDESLVARLTEAGFLSHPAVLVRAGAVPGWAYAIENITSRAPAHLAALSHGTRVYTVF
FT                   RSVNGEHEVGYAVNGRVLAYYQPQVGHSAGAGGEPGVPGFGYCGEEPPDVAFLRFLERE
FT                   HGIHVSWEAFQAPLPTAAFARGS"
     MVPPESAVPA DQSGNQCRRA PTGLRCHVSR RVRGAVDVAN GLRWISTAYD LGYTFTLCEG        60
     IGPRDLLARM GAEPHHLHEL SDDVVAELQM RPEDGHLSDL DFLDREDESL VARLTEAGFL       120
     SHPAVLVRAG AVPGWAYAIE NITSRAPAHL AALSHGTRVY TVFRSVNGEH EVGYAVNGRV       180
     LAYYQPQVGH SAGAGGEPGV PGFGYCGEEP PDVAFLRFLE REHGIHVSWE AFQAPLPTAA       240
     FARGS                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page