(data stored in ACNUC7421 zone)

EMBL: AP009493.PE241

AP009493.PE241       Location/Qualifiers
FT   CDS             257909..258361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_241"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17070"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNP7"
FT                   /protein_id="BAG17070.1"
FT                   /translation="MAVREGYRYCRGGEHVSWPDVIILVPVEQRPALEGRIRTLGRLVP
FT                   DPVTGCERLYRNGFSYALDLSGRILAEYEPDELDQVTALVGAPYAVHVSCQSMEAARTL
FT                   LREVLPGVDGLVDTNHFEILPVSGFLGLLARHPEWDWRRRPSTELP"
     MAVREGYRYC RGGEHVSWPD VIILVPVEQR PALEGRIRTL GRLVPDPVTG CERLYRNGFS        60
     YALDLSGRIL AEYEPDELDQ VTALVGAPYA VHVSCQSMEA ARTLLREVLP GVDGLVDTNH       120
     FEILPVSGFL GLLARHPEWD WRRRPSTELP                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page