(data stored in ACNUC7421 zone)

EMBL: AP009493.PE242

AP009493.PE242       Location/Qualifiers
FT   CDS             complement(258408..258854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_242"
FT                   /product="putative pyridoxamine 5'-phosphate
FT                   oxidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_242"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17071"
FT                   /db_xref="GOA:B1VNP8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNP8"
FT                   /protein_id="BAG17071.1"
FT                   /translation="MTAIFDEAVRARLRAANIWYVGTVFADGAPQVSPMWVDLEGEGEL
FT                   TFNTSVGRVKEENLRRDPRVYLSHADAADPFDRVQISGEVARFVEGAEAHERMDRLARK
FT                   YLGVERFEWTMPGERRVAVIVRPVKVRHIVGVERFRPGGPVPAP"
     MTAIFDEAVR ARLRAANIWY VGTVFADGAP QVSPMWVDLE GEGELTFNTS VGRVKEENLR        60
     RDPRVYLSHA DAADPFDRVQ ISGEVARFVE GAEAHERMDR LARKYLGVER FEWTMPGERR       120
     VAVIVRPVKV RHIVGVERFR PGGPVPAP                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page