(data stored in ACNUC7421 zone)

EMBL: AP009493.PE245

AP009493.PE245       Location/Qualifiers
FT   CDS             complement(263317..263991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_245"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17074"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNQ1"
FT                   /protein_id="BAG17074.1"
FT                   /translation="MSGSPRYLRYPGGPPPCDRTHRTPPSPPSGRTALPSRHSLAALLF
FT                   LAGALLSGCGIQETGVVAAGRPPVGDLLPPRDSRVLLFFLSPDDELLPVPRIVDVPWQG
FT                   DSGSPSPDGEEASEVLSPLTAVTALLDGPNKAERKAGLRNAPSLPREASAADRVVTGAS
FT                   TVEVRLDLRVRRLSAPARDQLVCTAAFAAHTQGALPVVLIGQDGRLAPAHCSLRPVPAP
FT                   AR"
     MSGSPRYLRY PGGPPPCDRT HRTPPSPPSG RTALPSRHSL AALLFLAGAL LSGCGIQETG        60
     VVAAGRPPVG DLLPPRDSRV LLFFLSPDDE LLPVPRIVDV PWQGDSGSPS PDGEEASEVL       120
     SPLTAVTALL DGPNKAERKA GLRNAPSLPR EASAADRVVT GASTVEVRLD LRVRRLSAPA       180
     RDQLVCTAAF AAHTQGALPV VLIGQDGRLA PAHCSLRPVP APAR                        224
//

If you have problems or comments...

PBIL Back to PBIL home page