(data stored in ACNUC7421 zone)

EMBL: AP009493.PE246

AP009493.PE246       Location/Qualifiers
FT   CDS             complement(264078..265604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_246"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_246"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17075"
FT                   /db_xref="GOA:B1VNQ2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNQ2"
FT                   /protein_id="BAG17075.1"
FT                   /translation="MKIPGASAAFGVRTRLVLAFLLVAAVSAVTTAALTYREARSAVLE
FT                   RAQDTAVASFREEVERFVPGLPLDLEAVRWELYDIAARSKPHPWIVFAEYGSTRVSSGD
FT                   RPVSGVLTEDLRRAARTAPHGSFQRVVKDGKAYLTIGMPVMTRVVAGGGAVPSGLILFA
FT                   VMPMTNEETDIDALVTAARDGALPGLAVALVPALFAARSVLRPVRELRRAADSMGGGRL
FT                   DARIAVRGRDEMADLARTFNSSAARLEHSVQELRDAGARARRFASDVSHELRTPLAGML
FT                   AVTDVLDEEAATLDPDTARAVRLISAETGKLAVLVEDLMEMSRFDARAAELTTDEVDAA
FT                   EAVRRSLSGRKWQDRVRAELPEGIRIRLDPRRFDVIVANLVGNALHHGAEPVTVRLSSR
FT                   AGSLITEVRDSGPGIAPDALPHVFDRFYKADAARSRSSGSGLGLAITQENVRLHGGTIR
FT                   AQNAPGGGALFTVELPFDGPASGHGAPDGPATAHGEGPGTGPHTSTEAGA"
     MKIPGASAAF GVRTRLVLAF LLVAAVSAVT TAALTYREAR SAVLERAQDT AVASFREEVE        60
     RFVPGLPLDL EAVRWELYDI AARSKPHPWI VFAEYGSTRV SSGDRPVSGV LTEDLRRAAR       120
     TAPHGSFQRV VKDGKAYLTI GMPVMTRVVA GGGAVPSGLI LFAVMPMTNE ETDIDALVTA       180
     ARDGALPGLA VALVPALFAA RSVLRPVREL RRAADSMGGG RLDARIAVRG RDEMADLART       240
     FNSSAARLEH SVQELRDAGA RARRFASDVS HELRTPLAGM LAVTDVLDEE AATLDPDTAR       300
     AVRLISAETG KLAVLVEDLM EMSRFDARAA ELTTDEVDAA EAVRRSLSGR KWQDRVRAEL       360
     PEGIRIRLDP RRFDVIVANL VGNALHHGAE PVTVRLSSRA GSLITEVRDS GPGIAPDALP       420
     HVFDRFYKAD AARSRSSGSG LGLAITQENV RLHGGTIRAQ NAPGGGALFT VELPFDGPAS       480
     GHGAPDGPAT AHGEGPGTGP HTSTEAGA                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page