(data stored in ACNUC7421 zone)

EMBL: AP009493.PE25

AP009493.PE25        Location/Qualifiers
FT   CDS             complement(30612..32018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_25t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_25t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16854"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKM8"
FT                   /protein_id="BAG16854.1"
FT                   /translation="MFRDHCAVLNTPRDRSCLSEGEVVPRTPNENLRVLVRRSGWSYSQ
FT                   LARAVRLVAAEHERPVLCDHTSVTRWIAGTQPRPPASTFLIEALSRKLGRRITAQQAGL
FT                   TRAPETSLILSWQDDPLFRLGLLVEFELDPARVHLLEAGTYRPSALSPPDPWGPLGSTV
FT                   TAPAPATGRIGGAEADQLRSMTQMFGASIAQHGGQAMRAALAAYLAHTVTPWLHGPASD
FT                   STHREVLSYGAQLTLLLADACIDADGHVATQHYQQLAARLAADAGDHATVAIALRAMAT
FT                   HASSLGHRGPAVLHLTQRAVEHARHAPPAVRSYAYAHLAVVQAHHNRRAALDALASAER
FT                   IHPERADTPPGPFTSYPKGALHYQRAQTLDALKDTPGALRALNASLHARTPGEHRAALL
FT                   THARLAEMLLRHGHLERALAQWYIFVDEYPTLRSPRTHRLLAVMQGQLRHHIRHAGARV
FT                   LLARAETLLR"
     MFRDHCAVLN TPRDRSCLSE GEVVPRTPNE NLRVLVRRSG WSYSQLARAV RLVAAEHERP        60
     VLCDHTSVTR WIAGTQPRPP ASTFLIEALS RKLGRRITAQ QAGLTRAPET SLILSWQDDP       120
     LFRLGLLVEF ELDPARVHLL EAGTYRPSAL SPPDPWGPLG STVTAPAPAT GRIGGAEADQ       180
     LRSMTQMFGA SIAQHGGQAM RAALAAYLAH TVTPWLHGPA SDSTHREVLS YGAQLTLLLA       240
     DACIDADGHV ATQHYQQLAA RLAADAGDHA TVAIALRAMA THASSLGHRG PAVLHLTQRA       300
     VEHARHAPPA VRSYAYAHLA VVQAHHNRRA ALDALASAER IHPERADTPP GPFTSYPKGA       360
     LHYQRAQTLD ALKDTPGALR ALNASLHART PGEHRAALLT HARLAEMLLR HGHLERALAQ       420
     WYIFVDEYPT LRSPRTHRLL AVMQGQLRHH IRHAGARVLL ARAETLLR                    468
//

If you have problems or comments...

PBIL Back to PBIL home page