(data stored in ACNUC7421 zone)

EMBL: AP009493.PE250

AP009493.PE250       Location/Qualifiers
FT   CDS             complement(268039..270015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_250"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17079"
FT                   /db_xref="GOA:B1VNQ6"
FT                   /db_xref="InterPro:IPR010420"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNQ6"
FT                   /protein_id="BAG17079.1"
FT                   /translation="MESAKGRPRVPLRDWARYRFDRTLARSTGTLMGWLVITCLAVVVP
FT                   VSLLLVWTDPGSPASLSGRLIATWRMSAETLRLGAATGTPPRLVLSAVLGLVALLCVST
FT                   LVGVITTGLAERMAELSRGRSTVLEQGHVLVLGWSDQVTTVVGELVAARAPRRPRAIVL
FT                   LADRDKSEMEEALTARGGPASRARIICRSGPASDPEVLARVSPRSASTVVVLPSNGPTA
FT                   DAEVLRVLLGLRAVLGEGTDGPPVLAAIRDDRYRAPARLAAGPRGTVLETDTVTARLIA
FT                   QCVGRPGLSLVLRDLLDFAGDEFHLADSTAFHHGPFGPTLLSHPHSCVVGLLTPEGRTL
FT                   LNPPADTAVLPGSRLIVLARDDDSTRVEDCRHLVDAAVIAPARPEPDDPSRLLLLGWNR
FT                   RAPLVLDQLRSTARTGSSVEVVADSAVPGPRGTEDRQPAGRDVRFRQAPLSRPETLLGL
FT                   DLDRYDAVVVLGPDRGDGPDHPDDWTLVALLAVRLLDGRTGRETRVVTELVDDRNRPLA
FT                   PVNSGSDVIVSGMLIGLLMAQIAQNRHLAAVFEELLSAEGNTVCLRPAGAYIRPGAEAT
FT                   FAGVVAAARDRGECAIGYRRHDITRTGTGDQGIRLNPPKGERRVWYAEDQVVVIATDHH
FT                   GPPAPAAGPDASDTADSAPSGAR"
     MESAKGRPRV PLRDWARYRF DRTLARSTGT LMGWLVITCL AVVVPVSLLL VWTDPGSPAS        60
     LSGRLIATWR MSAETLRLGA ATGTPPRLVL SAVLGLVALL CVSTLVGVIT TGLAERMAEL       120
     SRGRSTVLEQ GHVLVLGWSD QVTTVVGELV AARAPRRPRA IVLLADRDKS EMEEALTARG       180
     GPASRARIIC RSGPASDPEV LARVSPRSAS TVVVLPSNGP TADAEVLRVL LGLRAVLGEG       240
     TDGPPVLAAI RDDRYRAPAR LAAGPRGTVL ETDTVTARLI AQCVGRPGLS LVLRDLLDFA       300
     GDEFHLADST AFHHGPFGPT LLSHPHSCVV GLLTPEGRTL LNPPADTAVL PGSRLIVLAR       360
     DDDSTRVEDC RHLVDAAVIA PARPEPDDPS RLLLLGWNRR APLVLDQLRS TARTGSSVEV       420
     VADSAVPGPR GTEDRQPAGR DVRFRQAPLS RPETLLGLDL DRYDAVVVLG PDRGDGPDHP       480
     DDWTLVALLA VRLLDGRTGR ETRVVTELVD DRNRPLAPVN SGSDVIVSGM LIGLLMAQIA       540
     QNRHLAAVFE ELLSAEGNTV CLRPAGAYIR PGAEATFAGV VAAARDRGEC AIGYRRHDIT       600
     RTGTGDQGIR LNPPKGERRV WYAEDQVVVI ATDHHGPPAP AAGPDASDTA DSAPSGAR         658
//

If you have problems or comments...

PBIL Back to PBIL home page